PIP, Recombinant, Human, aa29-146, His-Tag (Prolactin-inducible protein)

PIP, Recombinant, Human, aa29-146, His-Tag (Prolactin-inducible protein)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
374711.10 10 µg - -

3 - 19 business days*

374711.50 50 µg - -

3 - 19 business days*

374711.100 100 µg - -

3 - 19 business days*

374711.200 200 µg - -

3 - 19 business days*

Source:|Recombinant protein corresponding to 29-146 from human PIP, fused to His-Tag at... more
Product information "PIP, Recombinant, Human, aa29-146, His-Tag (Prolactin-inducible protein)"
Source:, Recombinant protein corresponding to 29-146 from human PIP, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~17.5kD, AA Sequence: QDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: PIP, gp17, SABP, GCDFP15, GCDFP-15, Prolactin-induced protein, Prolactin-inducible protein, Secretory actin-binding protein, Gross cystic disease fluid protein 15
Supplier: United States Biological
Supplier-Nr: 374711


Conjugate: No
MW: 17,5
Format: Purified

Database Information

UniProt ID : P12273 | Find alternatives
Gene ID GeneID 5304 | Find alternatives

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow. more
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "PIP, Recombinant, Human, aa29-146, His-Tag (Prolactin-inducible protein)"
Write a review
or to review a product.