Lgals7, Recombinant, Mouse, aa2-136, His-Tag (Galectin-7)

Lgals7, Recombinant, Mouse, aa2-136, His-Tag (Galectin-7)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
374022.10 10 µg - -

3 - 19 business days*

406.00€
374022.50 50 µg - -

3 - 19 business days*

545.00€
374022.100 100 µg - -

3 - 19 business days*

781.00€
374022.200 200 µg - -

3 - 19 business days*

1,109.00€
 
Could be involved in cell-cell and/or cell-matrix interactions necessary for normal growth... more
Product information "Lgals7, Recombinant, Mouse, aa2-136, His-Tag (Galectin-7)"
Could be involved in cell-cell and/or cell-matrix interactions necessary for normal growth control. Pro-apoptotic protein that functions intracellularly upstream of JNK activation and cytochrome c release. Source: Recombinant protein corresponding to aa2-136 from mouse Lgals7, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~19kD, AA Sequence: SATHHKTSLPQGVRVGTVMRIRGLVPDQAGRFHVNLLCGEEQGADAALHFNPRLDTSEVVFNTKQQGKWGREERGTGIPFQRGQPFEVLLIATEEGFKAVVGDDEYLHFHHRLPPARVRLVEVGGDVQLHSLNI, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: Gal-7, Lgals7, Galectin-7
Supplier: United States Biological
Supplier-Nr: 374022

Properties

Conjugate: No
MW: 19
Format: Highly Purified

Database Information

UniProt ID : O54974 | Find alternatives

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow. more
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Lgals7, Recombinant, Mouse, aa2-136, His-Tag (Galectin-7)"
Write a review
or to review a product.
Viewed