ATAD2A, Recombinant, Human, aa981-1108, His-Tag (ANCCA, ATPase Family AAA Domain-containing Protein

ATAD2A, Recombinant, Human, aa981-1108, His-Tag (ANCCA, ATPase Family AAA Domain-containing Protein
Item number Size Datasheet Manual SDS Delivery time Quantity Price
298326.100 100 µg - -

3 - 19 business days*

937.00€
 
A large family of ATPases has been described, whose key feature is that they share a conserved... more
Product information "ATAD2A, Recombinant, Human, aa981-1108, His-Tag (ANCCA, ATPase Family AAA Domain-containing Protein"
A large family of ATPases has been described, whose key feature is that they share a conserved region of about 220 amino acids that contains an ATP-binding site. The proteins that belong to this family either contain one or two AAA (ATPases Associated with diverse cellular Activities) domains. AAA family proteins often perform chaperone-like functions that assist in the assembly, operation, or disassembly of protein complexes. The protein encoded by this gene contains two AAA domains, as well as a bromodomain. [provided by RefSeq, Jul 2008]. Source: Recombinant protein corresponding to aa981-1108 from human Bromodomain ATAD2A, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~16.2kD, AA Sequence: MHHHHHHQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLS, SVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELD, EDFEQLCEEIQESR, Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Keywords: L16, ANCCA, ATAD2, EC=3.6.1.3, ATPase family AAA domain-containing protein 2, AAA nuclear coregulator cancer-associated protein
Supplier: United States Biological
Supplier-Nr: 298326

Properties

Conjugate: No
MW: 16,2
Format: Highly Purified

Handling & Safety

Storage: -80°C
Shipping: -80°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "ATAD2A, Recombinant, Human, aa981-1108, His-Tag (ANCCA, ATPase Family AAA Domain-containing Protein"
Write a review
or to review a product.
Viewed