BNP, Human (Natriuretic Peptides B, Gamma-brain Natriuretic Peptide, NPPB)

BNP, Human (Natriuretic Peptides B, Gamma-brain Natriuretic Peptide, NPPB)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
B2702-30A.1 1 mg - -

3 - 19 business days*

Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions... more
Product information "BNP, Human (Natriuretic Peptides B, Gamma-brain Natriuretic Peptide, NPPB)"
Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. It helps to restore the body's salt and H2O balance and improves heart function. B-type Natriuretic Peptide Human is a polypeptide chain containing 32aa and having a molecular mass of 3464D. AA Sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH-OH, Molecular Weight: ~3.464kD, Storage and Stability: Lyophilized powder may be stored at -20°C. Reconstitute with ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplier: United States Biological
Supplier-Nr: B2702-30A


Conjugate: No
Format: Highly Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow. more
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "BNP, Human (Natriuretic Peptides B, Gamma-brain Natriuretic Peptide, NPPB)"
Write a review
or to review a product.