IL3, Recombinant, Human, aa20-152, GST-Tag (Interleukin-2)

IL3, Recombinant, Human, aa20-152, GST-Tag (Interleukin-2)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
373819.10 10 µg - -

3 - 19 business days*

354.00€
373819.50 50 µg - -

3 - 19 business days*

472.00€
373819.100 100 µg - -

3 - 19 business days*

658.00€
373819.200 200 µg - -

3 - 19 business days*

906.00€
 
Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by... more
Product information "IL3, Recombinant, Human, aa20-152, GST-Tag (Interleukin-2)"
Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes. Source: Recombinant protein corresponding to aa20-152 from human IL-3, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.1kD, AA Sequence: APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: IL3, IL-3, MCGF, Interleukin-3, Mast cell growth factor, P-cell-stimulating factor, Hematopoietic growth factor, Multipotential colony-stimulating factor
Supplier: United States Biological
Supplier-Nr: 373819

Properties

Conjugate: No
MW: 42,1
Format: Highly Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow. more
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "IL3, Recombinant, Human, aa20-152, GST-Tag (Interleukin-2)"
Write a review
or to review a product.
Viewed