IL1F10, Recombinant, Human, aa1-152, His-SUMO-Tag (Interleukin-1 Family Member 10)

IL1F10, Recombinant, Human, aa1-152, His-SUMO-Tag (Interleukin-1 Family Member 10)
Please request pricing for this article.
Request Pricing

Item number Size Datasheet Manual SDS Delivery time Quantity Price
373807.10 10 µg - -

4 - 22 business days

373807.100 100 µg - -

4 - 22 business days

373807.200 200 µg - -

4 - 22 business days

373807.50 50 µg - -

4 - 22 business days

Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces... more
Product information "IL1F10, Recombinant, Human, aa1-152, His-SUMO-Tag (Interleukin-1 Family Member 10)"
Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic cells stimulated by bacterial lipopolysaccharides (LPS). Ligand for IL-36R/IL1RL2. Source: Recombinant protein corresponding to aa1-152 from human IF1F10, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~32.9kD, AA Sequence: MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: IL-38, FIL1T, FKSG75, IL1F10, IL-1HY2, IL-1F10, FIL1 theta, IL-1 theta, Interleukin-38, Interleukin-1 HY2, Interleukin-1 theta, Family of interleukin 1-theta, Interleukin-1 family member 10
Supplier: United States Biological
Supplier-Nr: 373807


MW: 32,9
Format: Highly Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "IL1F10, Recombinant, Human, aa1-152, His-SUMO-Tag (Interleukin-1 Family Member 10)"
Write a review
or to review a product.
Information about the product reference will follow. more