Epidermal Growth Factor, Recombinant, Rat (EGF, Pro-epidermal Growth Factor)

Epidermal Growth Factor, Recombinant, Rat (EGF, Pro-epidermal Growth Factor)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
E3374-11U.20 20 µg - -

3 - 19 business days*

E3374-11U.100 100 µg - -

3 - 19 business days*

Epidermal growth factor has a profound effect on the differentiation of specific cells in vivo... more
Product information "Epidermal Growth Factor, Recombinant, Rat (EGF, Pro-epidermal Growth Factor)"
Epidermal growth factor has a profound effect on the differentiation of specific cells in vivo and is a potent mitogenic factor for a variety of cultured cells of both ectodermal and mesodermal origin. The EGF precursor is believed to exist as a membrane-bound molecule which is proteolytically cleaved to generate the 53aa peptide hormone that stimulates cells to divide. EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Epidermal Growth Factor Rat Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 53aa and having a molecular mass of 6151D. The Rat EGF is purified by proprietary chromatographic techniques. Source: Recombinant corresponding to rat EGF expressed in E. coli. AA Sequence: NSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR, Molecular Weight: ~6.151kD, Biological Activity: The ED50 as calculated by the dose-dependent proliferation of murine BALB/c 3T3 cells is less than 0.1ng/ml, corresponding to a specific activity of >1x10e7units/mg. Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplier: United States Biological
Supplier-Nr: E3374-11U


Conjugate: No
Format: Highly Purified

Database Information

UniProt ID : P07522 | Matching products

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow. more
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Epidermal Growth Factor, Recombinant, Rat (EGF, Pro-epidermal Growth Factor)"
Write a review
or to review a product.