Connective Tissue Growth Factor, Recombinant, Human, aa253-349, His-Tag (CTGF)

Connective Tissue Growth Factor, Recombinant, Human, aa253-349, His-Tag (CTGF)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
517851.10 10 µg - -

3 - 19 business days

354.00€
517851.50 50 µg - -

3 - 19 business days

472.00€
517851.100 100 µg - -

3 - 19 business days

658.00€
517851.200 200 µg - -

3 - 19 business days

906.00€
 
Major connective tissue mitogen attractant secreted by vascular endothelial cells. Promotes... more
Product information "Connective Tissue Growth Factor, Recombinant, Human, aa253-349, His-Tag (CTGF)"
Major connective tissue mitogen attractant secreted by vascular endothelial cells. Promotes proliferation and differentiation of chondrocytes. Mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells. Enhances fibroblast growth factor-induced DNA synthesis. Source: Recombinant protein corresponding to aa253-349 of human Connective Tissue Growth Factor, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~15.1kD, AA Sequence: GKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: IBP-8, IGFBP-8, CCN family member 2, IGF-binding protein 8, Connective tissue growth factor, Cellular communication network factor 2, Hypertrophic chondrocyte-specific protein 24, Insulin-like growth factor-binding protein 8
Supplier: United States Biological
Supplier-Nr: 517851

Properties

Conjugate: No
Expressed in: E.coli
Origin: Human
MW: 15.1 kD
Purity: >=90% (SDS-PAGE)

Database Information

KEGG ID : K06827 | Find alternatives
UniProt ID : P29279 | Find alternatives

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Connective Tissue Growth Factor, Recombinant, Human, aa253-349, His-Tag (CTGF)"
Write a review
or to review a product.
Information about the product reference will follow. more
Viewed