CCL18, Recombinant, Human, aa21-89, His-Tag (C-C Motif Chemokine 18)

CCL18, Recombinant, Human, aa21-89, His-Tag (C-C Motif Chemokine 18)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
372621.10 10 µg - -

3 - 19 business days*

375.00€
372621.50 50 µg - -

3 - 19 business days*

500.00€
372621.100 100 µg - -

3 - 19 business days*

707.00€
372621.200 200 µg - -

3 - 19 business days*

986.00€
 
Chemotactic factor that attracts lymphocytes but not monocytes or granulocytes. May be involved... more
Product information "CCL18, Recombinant, Human, aa21-89, His-Tag (C-C Motif Chemokine 18)"
Chemotactic factor that attracts lymphocytes but not monocytes or granulocytes. May be involved in B-cell migration into B-cell follicles in lymph nodes. Attracts naive T-lymphocytes toward dendritic cells and activated macrophages in lymph nodes, has chemotactic activity for naive T-cells, CD4+ and CD8+ T-cells and thus may play a role in both humoral and cell-mediated immunity responses. Source: Recombinant protein corresponding to aa21-89 from human CCL18, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~9.9kD, AA Sequence: AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: AMAC1, CCL18
Supplier: United States Biological
Supplier-Nr: 372621

Properties

Conjugate: No
MW: 9,9
Format: Highly Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow. more
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "CCL18, Recombinant, Human, aa21-89, His-Tag (C-C Motif Chemokine 18)"
Write a review
or to review a product.
Viewed