CCL14, Recombinant, Human, aa20-93, His-SUMO-Tag (C-C Motif Chemokine 14)

CCL14, Recombinant, Human, aa20-93, His-SUMO-Tag (C-C Motif Chemokine 14)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
372619.10 10 µg - -

3 - 19 business days*

354.00€
372619.50 50 µg - -

3 - 19 business days*

472.00€
372619.100 100 µg - -

3 - 19 business days*

658.00€
372619.200 200 µg - -

3 - 19 business days*

906.00€
 
Has weak activities on human monocytes and acts via receptors that also recognize MIP-1 alpha. It... more
Product information "CCL14, Recombinant, Human, aa20-93, His-SUMO-Tag (C-C Motif Chemokine 14)"
Has weak activities on human monocytes and acts via receptors that also recognize MIP-1 alpha. It induced intracellular Ca2+ changes and enzyme release, but no chemotaxis, at concentrations of 100-1,000 nM, and was inactive on T-lymphocytes, neutrophils, and eosinophil leukocytes. Enhances the proliferation of CD34 myeloid progenitor cells. The processed form HCC-1(9-74) is a chemotactic factor that attracts monocytes eosinophils, and T-cells and is a ligand for CCR1, CCR3 and CCR5. Source: Recombinant protein corresponding to aa20-93 from human CCL14, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~24.7kD, AA Sequence: TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: NCC2, CCL14
Supplier: United States Biological
Supplier-Nr: 372619

Properties

Conjugate: No
MW: 24,7
Format: Highly Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow. more
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "CCL14, Recombinant, Human, aa20-93, His-SUMO-Tag (C-C Motif Chemokine 14)"
Write a review
or to review a product.
Viewed