BMP7, Recombinant, Human, aa293-431, His-Tag (Bone Morphogenetic Protein 7)

BMP7, Recombinant, Human, aa293-431, His-Tag (Bone Morphogenetic Protein 7)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
372466.10 10 µg - -

3 - 19 business days*

372466.50 50 µg - -

3 - 19 business days*

372466.100 100 µg - -

3 - 19 business days*

372466.200 200 µg - -

3 - 19 business days*

Induces cartilage and bone formation. May be the osteoinductive factor responsible for the... more
Product information "BMP7, Recombinant, Human, aa293-431, His-Tag (Bone Morphogenetic Protein 7)"
Induces cartilage and bone formation. May be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. Plays a role in calcium regulation and bone homeostasis. Source: Recombinant protein corresponding to aa293-431 from human BMP7, fused to His-Tag at N-terminal expressed in E. coli. Molecular Weight: ~19.7kD, AA Sequence: STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: OP1, OP-1, BMP7, BMP-7, Eptotermin alfa, Osteogenic protein 1, Bone morphogenetic protein 7
Supplier: United States Biological
Supplier-Nr: 372466


Conjugate: No
MW: 19,7
Format: Highly Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow. more
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "BMP7, Recombinant, Human, aa293-431, His-Tag (Bone Morphogenetic Protein 7)"
Write a review
or to review a product.