BMP6, Recombinant, Human, aa382-513, His-Tag (Bone Morphogenetic Protein 6)

BMP6, Recombinant, Human, aa382-513, His-Tag (Bone Morphogenetic Protein 6)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
372464.10 10 µg - -

3 - 19 business days*

354.00€
372464.50 50 µg - -

3 - 19 business days*

472.00€
372464.100 100 µg - -

3 - 19 business days*

658.00€
372464.200 200 µg - -

3 - 19 business days*

906.00€
 
Induces cartilage and bone formation.||Source:|Recombinant protein corresponding to aa382-513... more
Product information "BMP6, Recombinant, Human, aa382-513, His-Tag (Bone Morphogenetic Protein 6)"
Induces cartilage and bone formation. Source: Recombinant protein corresponding to aa382-513 from human BMP6, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~18.9kD, AA Sequence: QQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: VGR, BMP6, BMP-6, VGR-1, VG-1-R, VG-1-related protein, Bone morphogenetic protein 6
Supplier: United States Biological
Supplier-Nr: 372464

Properties

Conjugate: No
MW: 18,9
Format: Highly Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow. more
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "BMP6, Recombinant, Human, aa382-513, His-Tag (Bone Morphogenetic Protein 6)"
Write a review
or to review a product.
Viewed