BMP6, Recombinant, Human, aa382-513, His-Tag (Bone Morphogenetic Protein 6)

Induces cartilage and bone formation. Source: Recombinant protein corresponding to aa382-513 from human BMP6, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~18.9kD, AA Sequence: QQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.