Beta-defensin 1, Recombinant, Mouse, aa33-69, His-SUMO-Tag (Defb1)

Beta-defensin 1, Recombinant, Mouse, aa33-69, His-SUMO-Tag (Defb1)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
372437.10 10 µg - -

3 - 19 business days*

449.00€
372437.50 50 µg - -

3 - 19 business days*

605.00€
372437.100 100 µg - -

3 - 19 business days*

886.00€
372437.200 200 µg - -

3 - 19 business days*

1,281.00€
 
Has bactericidal activity.||Source:|Recombinant protein corresponding to aa33-69 from mouse... more
Product information "Beta-defensin 1, Recombinant, Mouse, aa33-69, His-SUMO-Tag (Defb1)"
Has bactericidal activity. Source: Recombinant protein corresponding to aa33-69 from mouse Defb1, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~20.1kD, AA Sequence: DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: BD-1, mBD-1, Defb1, Beta-defensin 1, Defensin, beta 1
Supplier: United States Biological
Supplier-Nr: 372437

Properties

Conjugate: No
MW: 20,1
Format: Highly Purified

Database Information

UniProt ID : P56386 | Find alternatives
Gene ID GeneID 13214 | Find alternatives

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow. more
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Beta-defensin 1, Recombinant, Mouse, aa33-69, His-SUMO-Tag (Defb1)"
Write a review
or to review a product.
Viewed