Proteins and Peptides

3858 from 4287 pages
No results were found for the filter!
Complement C3, Recombinant, Mouse, aa1321-1663, His-SUMO-Tag (C3)
Complement C3, Recombinant, Mouse, aa1321-1663,...

Item number: 370569.100

C3 plays a central role in the activation of the complent syst. Its processing by C3 convertase is the central reaction in both classical and alternative complent pathways. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates. Derived from...
Keywords: C3
MW: 55,3
Please request pricing for this article.
Review
COVID-19 Research
Coronavirus Hemagglutinin-esterase, Recombinant, Bovine, aa19-424, His-Tag (HE)
Coronavirus Hemagglutinin-esterase, Recombinant, Bovine,...

Item number: 370571.10

Structural protein that makes short spikes at the surface of the virus. Contains receptor binding and receptor-destroying activities. Mediates de-O-acetylation of N-acetyl-9-O-acetylneuraminic acid, which is probably the receptor determinant recognized by the virus on the surface of erythrocytes and susceptible...
Keywords: 2b, HE protein, E3 glycoprotein, Hemagglutinin-esterase
MW: 47,7
From 475.00€ *
Review
ALPI, Recombinant, Human, aa26-500, His-Tag (Intestinal-type Alkaline Phosphatase)
ALPI, Recombinant, Human, aa26-500, His-Tag...

Item number: 370517.100

Source:, Recombinant protein corresponding to aa26-500 from human ALPI, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~55.6kD, AA Sequence:...
Keywords: IAP, ALPI, EC=3.1.3.1, Intestinal alkaline phosphatase, Intestinal-type alkaline phosphatase
MW: 55,6
Please request pricing for this article.
Review
Anionic Trypsin, Recombinant, Canine, aa24-247, His-SUMO-Tag
Anionic Trypsin, Recombinant, Canine, aa24-247, His-SUMO-Tag

Item number: 370520.100

Source:, Recombinant protein corresponding to aa224-247 from canine Anionic trypsin, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. AA Sequence: IVGGYTC EENSVPYQVS LNAGYHFCGG SLISDQWVVS AAHCYKSRIQ VRLGEYNIDV LEGNEQFINS AKVIRHPNYN SWILDNDIML IKLSSPAVLN ARVATISLPR ACAAPGTQCL ISGWGNTLSS GTNYPELLQC...
Keywords: EC=3.4.21.4, Anionic trypsin
Please request pricing for this article.
Review
Cytochrome P450 11B2, Mitochondrial, Recombinant, Human, aa25-503, His-Tag (CYP11B2)
Cytochrome P450 11B2, Mitochondrial, Recombinant, Human,...

Item number: 370578.10

Preferentially catalyzes the conversion of 11-deoxycorticosterone to aldosterone via corticosterone and 18-hydroxycorticosterone. Source: Recombinant protein corresponding to aa25-503 from human CYP11B2, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~56.06kD, AA Sequence:...
Keywords: ALDOS, CYP11B2, CYPXIB2, EC=1.14.15.5, EC=1.14.15.4, Cytochrome P-450C18, Aldosterone synthase, Cytochrome P-450Aldo,...
MW: 56,06
From 406.00€ *
Review
EntC2, Recombinant, Staphylococcus Aureus, aa28-266, His-SUMO-Tag (Enterotoxin Type C-2)
EntC2, Recombinant, Staphylococcus Aureus, aa28-266,...

Item number: 370601.10

Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness characterized by high fever, hypotension, diarrhea, shock, and in some cases death. Source: Recombinant protein corresponding to aa28-266 from Staphylococcus aureus EntC2, fused to His-SUMO-Tag at N-terminal,...
Keywords: SEC2, entC2, Enterotoxin type C-2
MW: 43,57
From 449.00€ *
Review
ESAT-6-like Protein EsxH, Recombinant, Mycobacterium Tuberculosis, aa2-96, His-SUMO-Tag (EsxH)
ESAT-6-like Protein EsxH, Recombinant, Mycobacterium...

Item number: 370605.100

Source:, Recombinant protein corresponding to aa2-96 from Mycobacterium tuberculosis esxH, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~26.25kD, AA Sequence: SQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGG, Storage and Stability: May...
Keywords: cfp7, CFP-7, MT0301, Protein TB10.4, 10 kDa antigen CFP7, ESAT-6-like protein EsxH, Low molecular weight protein antigen 7
MW: 26,25
Please request pricing for this article.
Review
FCRL6, Recombinant, Human, aa20-307, His-Tag (Fc Receptor-like Protein 6)
FCRL6, Recombinant, Human, aa20-307, His-Tag (Fc...

Item number: 370610.10

Source:, Recombinant protein corresponding to aa20-307 from human FCRL6, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~35.8kD, AA Sequence:...
Keywords: FCRL6, FcRH6, FCRH6, FcRL6, IFGP6, FcR-like protein 6, Fc receptor homolog 6, Fc receptor-like protein 6
MW: 35,8
From 378.00€ *
Review
Fgf15, Recombinant, Mouse, aa26-218, His-SUMO-Tag (Fibroblast Growth Factor 15)
Fgf15, Recombinant, Mouse, aa26-218, His-SUMO-Tag...

Item number: 370612.100

Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression. Source: Recombinant protein corresponding to aa26-218 from mouse Fgf15, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~37.23kD, AA Sequence:...
Keywords: Fgf15, FGF-15, Fibroblast growth factor 15
MW: 37,23
Please request pricing for this article.
Review
Frataxin, Mitochondrial, Recombinant, Rat, aa41-208, His-Tag (Fxn)
Frataxin, Mitochondrial, Recombinant, Rat, aa41-208,...

Item number: 370617.10

Promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe2+ to proteins involved in these pathways. May play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe2+ to Fe3+, the oligomeric form but not the...
Keywords: Fxn, EC=1.16.3.1
From 406.00€ *
Review
Galectin-9, Recombinant, Human, aa1-323, His-GST-Tag (LGALS9)
Galectin-9, Recombinant, Human, aa1-323, His-GST-Tag...

Item number: 370619.100

Binds galactosides. Has high affinity for the Forssman pentasaccharide. May play a role in thymocyte-epithelial interactions relevant to the biology of the thymus. Inhibits cell proliferation. It is a ligand for HAVCR2/TIM3. Induces T-helper type 1 lymphocyte (Th1) death. Isoform Short acts as an eosinophil...
Keywords: Gal-9, LGALS9, Ecalectin, Galectin-9, Tumor antigen HOM-HD-21
MW: 66,9
Please request pricing for this article.
Review
Gingipain R1, Recombinant, Porphyromonas Gingivalis, aa228-720, His-Tag (RgpA)
Gingipain R1, Recombinant, Porphyromonas Gingivalis,...

Item number: 370624.10

Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Its proteolytic activity is a major factor in both periodontal tissue destruction and in bacterial host defense mechanisms. Activates complent C3 and C5. Source: Recombinant protein corresponding to aa228-720 from...
Keywords: rgpA, rgp1, RGP-1, Gingipain 1, Gingipain R1, Arg-gingipain
MW: 55,9
From 475.00€ *
Review
3858 from 4287 pages