Anti-ZP3 / Zona pellucida glycoprotein 3

Anti-ZP3 / Zona pellucida glycoprotein 3
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4898 100 µg - -

3 - 10 business days

503.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Zona pellucida sperm-binding protein 3,... more
Product information "Anti-ZP3 / Zona pellucida glycoprotein 3"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Zona pellucida sperm-binding protein 3, also known as zona pellucida glycoprotein 3 (Zp-3) or the sperm receptor, is a ZP module-containing protein that in humans is encoded by the ZP3 gene. It is mapped to 7q11.23. he zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. The protein encoded by this gene is a structural component of the zona pellucida and functions in primary binding and induction of the sperm acrosome reaction. The nascent protein contains a N-terminal signal peptide sequence, a conserved ZP domain, a C-terminal consensus furin cleavage site, and a transmembrane domain. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix. However, the requirement for furin cleavage in this process remains controversial based on mouse studies. A variation in the last exon of this gene has previously served as the basis for an additional ZP3 locus, however, sequence and literature review reveals that there is only one full-length ZP3 locus in the human genome. Another locus encoding a bipartite transcript designated POMZP3 contains a duplication of the last four exons of ZP3, including the above described variation, and maps closely to this gene. Protein function: The mammalian zona pellucida, which mediates species- specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy, is composed of three to four glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP3 is essential for sperm binding and zona matrix formation. [The UniProt Consortium]
Keywords: Anti-ZP3, Anti-ZP3A, ZP3 Antibody / Zona pellucida glycoprotein 3
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4898

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Reactivity: Human
Immunogen: Amino acids LRLMEENWNAEKRSPTFHLGDAAHLQAEIHT from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-ZP3 / Zona pellucida glycoprotein 3"
Write a review
or to review a product.
Viewed