Anti-ZP1 / Zona pellucida sperm-binding protein 1

Anti-ZP1 / Zona pellucida sperm-binding protein 1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32398 100 µg - -

3 - 10 business days

0.5mg/ml if reconstituted with 0.2ml sterile DI water. Zona pellucida sperm-binding protein 1 is... more
Product information "Anti-ZP1 / Zona pellucida sperm-binding protein 1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Zona pellucida sperm-binding protein 1 is a protein that belopngs to the mammalian zona pellucida. The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. Zp1 ensures the structural integrity of the zona pellucida. Mutations in this gene are a cause of oocyte maturation defect and infertility. And this gene is mapped to chromosome 11q12.2. Protein function: The mammalian zona pellucida, which mediates species- specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy, is composed of three to four glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP1 ensures the structural integrity of the zona pellucida. [The UniProt Consortium]
Keywords: Anti-ZP1, ZP1 Antibody / Zona pellucida sperm-binding protein 1
Supplier: NSJ Bioreagents
Supplier-Nr: R32398


Application: WB
Antibody Type: Polyclonal
Host: Rabbit
Reactivity: Human, Rat
Immunogen: Amino acids HVLEKDGRFHLRVFMEAVLPNGRVDVAQDATLICPKPD were used as the immunogen for the ZP1 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-ZP1 / Zona pellucida sperm-binding protein 1"
Write a review
or to review a product.