Anti-TFIIE beta

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG59646.50	50 µl		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Recruits TFIIH to the initiation complex and stimulates the RNA polymerase II... more

Close menu

Product information "Anti-TFIIE beta"

Protein function: Recruits TFIIH to the initiation complex and stimulates the RNA polymerase II C-terminal domain kinase and DNA-dependent ATPase activities of TFIIH. Both TFIIH and TFIIE are required for promoter clearance by RNA polymerase. [The UniProt Consortium]

Keywords:	Anti-TF2E2, Anti-GTF2E2, Anti-TFIIE-beta, Anti-General transcription factor IIE subunit 2, Anti-Transcription initiation factor IIE subunit beta
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59646

Properties

Application:	IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human (Expected: mouse, rat, bovine, dog, goat, guinea pig, horse, rabbit, zebrafish)
Immunogen:	Synthetic peptide around the N-terminal region of Human TFIIE beta. (within the following region: VEHGGSSGSKQNSDHSNGSFNLKALSGSSGYKFGVLAKIVNYMKTRHQRG)
MW:	33 kD
Format:	Affinity Purified