Anti-TAGLN (Transgelin, 22kD Actin-binding Protein, Protein WS3-10, Smooth Muscle Protein 22-alpha,

Anti-TAGLN (Transgelin, 22kD Actin-binding Protein, Protein WS3-10, Smooth Muscle Protein 22-alpha,
Item number Size Datasheet Manual SDS Delivery time Quantity Price
134203.100 100 µg - -

3 - 19 business days*

699.00€
 
TAGLN (Transgelin), otherwise known as SM22-alpha, a shape change sensitive, actin... more
Product information "Anti-TAGLN (Transgelin, 22kD Actin-binding Protein, Protein WS3-10, Smooth Muscle Protein 22-alpha,"
TAGLN (Transgelin), otherwise known as SM22-alpha, a shape change sensitive, actin cross-linking/gelling protein, and member of the calponin family, which plays a role in calcium interactions and contractile properties of the cell. TAGLN is ubiquitously expressed by vascular and visceral smooth muscle, and an early marker of smooth muscle differentiation, and also overexpressed by senescent human fibroblasts. Studies have identified TAGLN as a novel tumor suppressor protein, which has a markedly reduced expression in colorectal cancer samples, and may serve as an important biomarker of malignancy. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 134203

Properties

Application: ELISA, WB
Antibody Type: Monoclonal
Clone: 1E2
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: Full length recombinant corresponding to aa1-202 from human TAGLN (AAH04927) with GST tag. MW of the GST tag alone is 26kD.
Purity: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-TAGLN (Transgelin, 22kD Actin-binding Protein, Protein WS3-10, Smooth Muscle Protein 22-alpha,"
Write a review
or to review a product.
Viewed