Anti-STAT2

Anti-STAT2
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG40763.50 50 µg - -

6 - 14 business days*

520.00€
 
Protein function: Signal transducer and activator of transcription that mediates signaling by... more
Product information "Anti-STAT2"
Protein function: Signal transducer and activator of transcription that mediates signaling by type I IFNs (IFN-alpha and IFN-beta). Following type I IFN binding to cell surface receptors, Jak kinases (TYK2 and JAK1) are activated, leading to tyrosine phosphorylation of STAT1 and STAT2. The phosphorylated STATs dimerize, associate with IRF9/ISGF3G to form a complex termed ISGF3 transcription factor, that enters the nucleus. ISGF3 binds to the IFN stimulated response element (ISRE) to activate the transcription of interferon stimulated genes, which drive the cell in an antiviral state (PubMed:9020188, PubMed:23391734). Acts as a regulator of mitochondrial fission by modulating the phosphorylation of DNM1L at 'Ser-616' and 'Ser-637' which activate and inactivate the GTPase activity of DNM1L respectively (PubMed:26122121). [The UniProt Consortium]
Keywords: Anti-p113, Anti-STAT2, Anti-Signal transducer and activator of transcription 2
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG40763

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: mouse, rat (Expected: human)
Immunogen: Synthetic peptide corresponding to a sequence of Human STAT2. (FQDQLHQLYSHSLLPVDIRQYLAVWIEDQNWQEA)
MW: 97 kD

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-STAT2"
Write a review
or to review a product.
Viewed