Anti-RBBP4 / RbAp48 / NURF55

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32202 100 µg - -

3 - 10 business days

503.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Retinoblastoma binding protein 4 (also... more
Product information "Anti-RBBP4 / RbAp48 / NURF55"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Retinoblastoma binding protein 4 (also known as RbAp48, or NURF55) is a protein that in humans is encoded by the RBBP4 gene. This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly. And it is part of the Mi-2 complex which has been implicated in chromatin remodeling and transcriptional repression associated with histone deacetylation. This encoded protein is also part of co-repressor complexes, which is an integral component of transcriptional silencing. It is found among several cellular proteins that bind directly to retinoblastoma protein to regulate cell proliferation. This protein also seems to be involved in transcriptional repression of E2F-responsive genes. Three transcript variants encoding different isoforms have been found for this gene. Protein function: Core histone-binding subunit that may target chromatin assembly factors, chromatin remodeling factors and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA. Component of several complexes which regulate chromatin metabolism. These include the chromatin assembly factor 1 (CAF-1) complex, which is required for chromatin assembly following DNA replication and DNA repair, the core histone deacetylase (HDAC) complex, which promotes histone deacetylation and consequent transcriptional repression, the nucleosome remodeling and histone deacetylase complex (the NuRD complex), which promotes transcriptional repression by histone deacetylation and nucleosome remodeling, the PRC2/EED-EZH2 complex, which promotes repression of homeotic genes during development, and the NURF (nucleosome remodeling factor) complex. [The UniProt Consortium]
Keywords: Anti-RBBP4, Anti-RBBP-4, Anti-RBAP48, Anti-CAF-I p48, Anti-CAF-1 subunit C, Anti-CAF-I 48 kDa subunit, Anti-Histone-binding protein RBBP4, Anti-Retinoblastoma-binding protein 4, Anti-Retinoblastoma-binding protein p48, RBBP4 Antibody / RbAp48 / NURF55
Supplier-Nr: R32202

Properties

Application: WB, IHC (paraffin), IHC (frozen)
Antibody Type: Polyclonal
Host: Rabbit
Reactivity: Human, Mouse, Rat
Immunogen: Amino acids EDNIMQVWQMAENIYNDEDPEGSVDPEGQGS of human Retinoblastoma binding protein 4 were used as the immunogen for the RBBP4 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-RBBP4 / RbAp48 / NURF55"
Write a review
or to review a product.
Viewed