Anti-Prostaglandin I Synthase

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG56505.50	50 µg		-	-	6 - 14 business days*		592.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Catalyzes the isomerization of prostaglandin H2 to prostacyclin (=... more

Close menu

Product information "Anti-Prostaglandin I Synthase"

Protein function: Catalyzes the isomerization of prostaglandin H2 to prostacyclin (= prostaglandin I2). [The UniProt Consortium]

Keywords:	Anti-CYP8, Anti-PTGIS, EC=5.3.99.4, Anti-Prostacyclin synthase, Anti-Prostaglandin I2 synthase
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG56505

Properties

Application:	WB, IP
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, bovine, sheep
Immunogen:	Synthetic peptide around aa. 299-329 of Bovine Prostaglandin I Synthase. (LLKNPEALAAVRGELETVLLGAEQPISQMTT)
Format:	Antigen Affinity Purified