Anti-Pokemon / ZBTB7A

Anti-Pokemon / ZBTB7A
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31846 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Zinc finger and BTB domain-containing... more
Product information "Anti-Pokemon / ZBTB7A"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Zinc finger and BTB domain-containing protein 7A, also called Pokemon and FBI-1, is a protein that in humans is encoded by the ZBTB7A gene. It has a critical oncosuppressive role in the prostate. Prostate-specific inactivation of ZBTB7A leads to a marked acceleration of PTEN loss-driven prostate tumorigenesis through bypass of PTEN loss-induced cellular senescence. It has been showed that ZBTB7A physically interacts with SOX9 and functionally antagonizes its transcriptional activity on key target genes such as MIA, which is involved in tumor cell invasion, and H19, a long noncoding RNA precursor for an RB-targeting microRNA. Inactivation of ZBTB7A in vivo leads to RB downregulation, bypass of PTEN loss-induced cellular senescence, and invasive prostate cancer. Notably, it has been also found that ZBTB7A is genetically lost, as well as downregulated at both the mRNA and protein levels, in a subset of human advanced prostate cancers. Therefore, ZBTB7A is identified as a context-dependent cancer gene that can act as an oncogene in some contexts but that also has oncosuppressive-like activity in PTEN-null tumors. Protein function: Plays a key role in the instruction of early lymphoid progenitors to develop into B lineage by repressing T-cell instructive Notch signals. Specifically represses the transcription of the CDKN2A gene. Efficiently abrogates E2F1- dependent CDKN2A transactivation/de-repression. Binds to the consensus sequence 5'-[GA][CA]GACCCCCCCCC-3'. [The UniProt Consortium]
Keywords: Anti-FBI1, Anti-TIP21, Anti-FBI-1, Anti-ZBTB7A, Anti-Pokemon, Anti-Zinc finger protein 857A, Anti-HIV-1 1st-binding protein 1, Anti-TTF-I-interacting peptide 21, Anti-Factor binding IST protein 1, Anti-Leukemia/lymphoma-related factor, Pokemon Antibody /
Supplier: NSJ Bioreagents
Supplier-Nr: R31846

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids DLLDRQILAADAGADAGQLDLVDQIDQRNLLRAKEYLEF of human ZBTB7A were used as the immunogen for the Pokemon antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Pokemon / ZBTB7A"
Write a review
or to review a product.
Viewed