Anti-PNPLA2 (PEDFR, Patatin-like Phospholipase Domain Containing 2, 1110001C14Rik, Adipose Triglycer

Anti-PNPLA2 (PEDFR, Patatin-like Phospholipase Domain Containing 2, 1110001C14Rik, Adipose Triglycer
Item number Size Datasheet Manual SDS Delivery time Quantity Price
131545.100 100 µg - -

3 - 19 business days*

699.00€
 
Triglycerides are the most efficient form of energy storage in mammalian adipose tissue during... more
Product information "Anti-PNPLA2 (PEDFR, Patatin-like Phospholipase Domain Containing 2, 1110001C14Rik, Adipose Triglycer"
Triglycerides are the most efficient form of energy storage in mammalian adipose tissue during times of caloric excess. ATGL is one of the key enzymes involved in the mobilization of fatty acids from triglyceride stores in adipose tissue, catalyzing the conversion of triacylglycerols to diacylglycerols. Inhibition of ATGL markedly decreases total adipose acyl-hydrolase activity, and thus may be a potential drug target for the diabetic pathology. ATGL mRNA is detected in a wide range of tissues including adipose, lung, skeletal muscle, testis, heart, brain, and kidney, with adipose tissue expressing the highest level. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SFTIRLLEWLPDVPEDIRWMKEQTGSICQYLVMRAKRKLGRHLPSRLPEQVELRRVQSLPSVPLSCAAYREALPGWMRNNLSLGDALAKWEECQRQLLLG, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 131545

Properties

Application: ELISA, WB
Antibody Type: Monoclonal
Clone: 2H1
Conjugate: No
Host: Mouse
Species reactivity: human
Format: Affinity Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-PNPLA2 (PEDFR, Patatin-like Phospholipase Domain Containing 2, 1110001C14Rik, Adipose Triglycer"
Write a review
or to review a product.
Viewed