Anti-PIAS3

Anti-PIAS3
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG59266.50 50 µl - -

6 - 14 business days*

520.00€
 
Protein function: Functions as an E3-type small ubiquitin-like modifier (SUMO) ligase,... more
Product information "Anti-PIAS3"
Protein function: Functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. Plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway and the steroid hormone signaling pathway. Involved in regulating STAT3 signaling via inhibiting STAT3 DNA-binding and suppressing cell growth. Enhances the sumoylation of MTA1 and may participate in its paralog-selective sumoylation (PubMed:21965678, PubMed:9388184). Sumoylates CCAR2 which promotes its interaction with SIRT1 (PubMed:25406032). Diminishes the sumoylation of ZFHX3 by preventing the colocalization of ZFHX3 with SUMO1 in the nucleus (PubMed:24651376). [The UniProt Consortium]
Keywords: Anti-PIAS3, EC=2.3.2.-, Anti-E3 SUMO-protein ligase PIAS3, Anti-E3 SUMO-protein transferase PIAS3, Anti-Protein inhibitor of activated STAT protein 3
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG59266

Properties

Application: ICC, IF, WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human (Expected: mouse, rat, bovine, dog, guinea pig, horse, swine)
Immunogen: Synthetic peptide around the C-terminal region of Human PIAS3. (within the following region: TSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSIV)
MW: 68 kD
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-PIAS3"
Write a review
or to review a product.
Viewed