Anti-PCSK6 / PACE4

Anti-PCSK6 / PACE4
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32047 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Proprotein convertase subtilisin/kexin... more
Product information "Anti-PCSK6 / PACE4"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Proprotein convertase subtilisin/kexin type 6 is an enzyme that in humans is encoded by the PCSK6 gene. This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. The encoded protein undergoes an initial autocatalytic processing event in the ER to generate a heterodimer which exits the ER and sorts to the trans-Golgi network where a second autocatalytic event takes place and the catalytic activity is acquired. The encoded protease is constitutively secreted into the extracellular matrix and expressed in many tissues, including neuroendocrine, liver, gut, and brain. This gene encodes one of the seven basic amino acid-specific members which cleave their substrates at single or paired basic residues. Some of its substrates include transforming growth factor beta related proteins, proalbumin, and von Willebrand factor. This gene is thought to play a role in tumor progression and left-right patterning. Alternatively spliced transcript variants encoding different isoforms have been identified. Protein function: Likely to represent an endoprotease activity within the constitutive secretory pathway, with unique restricted distribution in both neuroendocrine and non-neuroendocrine tissues and capable of cleavage at the RX(K/R)R consensus motif. [The UniProt Consortium]
Keywords: Anti-SPC4, Anti-PACE4, Anti-PCSK6, EC=3.4.21.-, Anti-Subtilisin/kexin-like protease PACE4, Anti-Subtilisin-like proprotein convertase 4, Anti-Paired basic amino acid cleaving enzyme 4, Anti-Proprotein convertase subtilisin/kexin type 6, PCSK6 Antibody / P
Supplier: NSJ Bioreagents
Supplier-Nr: R32047

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, rat
Immunogen: Amino acids RNPEKQGKLKEWSLILYGTAEHPYHTFSAHQSRSRMLE of human PCSK6/PACE4 were used as the immunogen for the PACE4 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-PCSK6 / PACE4"
Write a review
or to review a product.
Viewed