Anti-OTC (Ornithine carbamoyltransferase)

Anti-OTC (Ornithine carbamoyltransferase)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32654 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Ornithine transcarbamylase (OTC) (also... more
Product information "Anti-OTC (Ornithine carbamoyltransferase)"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Ornithine transcarbamylase (OTC) (also called ornithine carbamoyltransferase) is an enzyme that catalyzes the reaction between carbamoyl phosphate (CP) and ornithine (Orn) to form citrulline (Cit) and phosphate (Pi). This nuclear gene encodes a mitochondrial matrix enzyme. Missense, nonsense, and frameshift mutations in this enzyme lead to ornithine transcarbamylase deficiency, which causes hyperammonemia. Since the gene for this enzyme maps close to that for Duchenne muscular dystrophy, it may also play a role in that disease.
Keywords: Anti-OTC, Anti-OTCase, EC=2.1.3.3, Anti-Ornithine transcarbamylase, Anti-Ornithine carbamoyltransferase, mitochondrial, OTC Antibody (Ornithine carbamoyltransferase)
Supplier: NSJ Bioreagents
Supplier-Nr: R32654

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: mouse, rat
Immunogen: Amino acids 33-70 (NKVQLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQK) from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-OTC (Ornithine carbamoyltransferase)"
Write a review
or to review a product.
Viewed