Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
NSJ-R32222 | 100 µg | - | - |
3 - 10 business days* |
755.00€
|
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Solute carrier family 12... more
Product information "Anti-NKCC2 / SLC12A1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Solute carrier family 12 (sodium/potassium/chloride transporters), member 1, also called NKCC2 is specifically found in cells of the thick ascending limb of the loop of Henle in nephrons, the basic functional units of the kidney. This gene is mapped to 15q21.1. This gene encodes a kidney-specific sodium-potassium-chloride cotransporter that is expressed on the luminal membrane of renal epithelial cells of the thick ascending limb of Henle's loop and the macula densa. It plays a key role in concentrating urine and accounts for most of the NaCl resorption. It is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene. This gene plays a vital role in the regulation of ionic balance and cell volume. Protein function: Renal sodium, potassium and chloride ion cotransporter that mediates the transepithelial NaCl reabsorption in the thick ascending limb and plays an essential role in the urinary concentration and volume regulation. Electrically silent transporter system. [The UniProt Consortium]
Keywords: | Anti-NKCC2, Anti-SLC12A1, Anti-Kidney-specific Na-K-Cl symporter, Anti-Solute carrier family 12 member 1, Anti-Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2, NKCC2 Antibody / SLC12A1 |
Supplier: | NSJ Bioreagents |
Supplier-Nr: | R32222 |
Properties
Application: | WB, IHC (paraffin) |
Antibody Type: | Polyclonal |
Conjugate: | No |
Host: | Rabbit |
Species reactivity: | human, mouse, rat, monkey |
Immunogen: | Amino acids DEAQKRLRISFRPGNQECYDNFLQSGETAKTD of human SLC12A1 |
Format: | Purified |
Database Information
KEGG ID : | K14425 | Matching products |
UniProt ID : | Q13621 | Matching products |
Gene ID | GeneID 6557 | Matching products |
Handling & Safety
Storage: | +4°C |
Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed