Anti-Neuroserpin / SERPINI1

Anti-Neuroserpin / SERPINI1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32312 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Neuroserpin is a protein that in humans is... more
Product information "Anti-Neuroserpin / SERPINI1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Neuroserpin is a protein that in humans is encoded by the SERPINI1 gene. This gene encodes a member of the serpin superfamily of serine proteinase inhibitors. The protein is primarily secreted by axons in the brain, and preferentially reacts with and inhibits tissue-type plasminogen activator. It is thought to play a role in the regulation of axonal growth and the development of synaptic plasticity. Mutations in this gene result in familial encephalopathy with neuroserpin inclusion bodies (FENIB), which is a dominantly inherited form of familial encephalopathy and epilepsy characterized by the accumulation of mutant neuroserpin polymers. Multiple alternatively spliced variants, encoding the same protein, have been identified. Protein function: Serine protease inhibitor that inhibits plasminogen activators and plasmin but not thrombin. May be involved in the formation or reorganization of synaptic connections as well as for synaptic plasticity in the adult nervous system. May protect neurons from cell damage by tissue-type plasminogen activator. [The UniProt Consortium]
Keywords: Anti-PI12, Anti-PI-12, Anti-SERPINI1, Anti-Serpin I1, Anti-Neuroserpin, Anti-Peptidase inhibitor 12, Neuroserpin Antibody / SERPINI1
Supplier: NSJ Bioreagents
Supplier-Nr: R32312

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids KAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKA L of human Neuroserpin/SERPINI1 were used as the immunogen for the Neuroserpin antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Neuroserpin / SERPINI1"
Write a review
or to review a product.
Viewed