Anti-Musashi 1

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG41352.50 50 µg - -

6 - 14 business days*

551.00€
 
Protein function: RNA binding protein that regulates the expression of target mRNAs at the... more
Product information "Anti-Musashi 1"
Protein function: RNA binding protein that regulates the expression of target mRNAs at the translation level. Regulates expression of the NOTCH1 antagonist NUMB. Binds RNA containing the sequence 5'- GUUAGUUAGUUAGUU-3' and other sequences containing the pattern 5'- [GA]U(1-3)AGU-3'. May play a role in the proliferation and maintenance of stem cells in the central nervous system. [The UniProt Consortium]
Keywords: Anti-MSI1, Anti-Musashi-1, Anti-RNA-binding protein Musashi homolog 1
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG41352

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Synthetic peptide corresponding to aa. 21-54 of Human Musashi 1. (KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD)
MW: 39 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Musashi 1"
Write a review
or to review a product.
Viewed