Anti-MDM4 / MDMX

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG59046.50	50 µg		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Inhibits p53/TP53- and TP73/p73-mediated cell cycle arrest and apoptosis by... more

Close menu

Product information "Anti-MDM4 / MDMX"

Protein function: Inhibits p53/TP53- and TP73/p73-mediated cell cycle arrest and apoptosis by binding its transcriptional activation domain. Inhibits degradation of MDM2. Can reverse MDM2-targeted degradation of TP53 while maintaining suppression of TP53 transactivation and apoptotic functions. [The UniProt Consortium]

Keywords:	Anti-MDMX, Anti-MDM4, Anti-Protein Mdm4, Anti-Protein Mdmx, Anti-Double minute 4 protein, Anti-p53-binding protein Mdm4, Anti-Mdm2-like p53-binding protein
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59046

Properties

Application:	IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse (Expected: bovine, horse, monkey, rabbit)
Immunogen:	Synthetic peptide corresponding to aa. 35-72 of Human MDMX (KILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQH)
MW:	55 kD
Format:	Antigen Affinity Purified