Anti-ITLN1 / Intelectin-1

Anti-ITLN1 / Intelectin-1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32441 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Intelectin-1, also known as omentin, is an... more
Product information "Anti-ITLN1 / Intelectin-1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Intelectin-1, also known as omentin, is an intelectin encoded in humans by the ITLN1 gene. This gene is mapped to chromosome 1q21.3-q22 by genomic sequence analysis. It is expressed on multiple cell types and appears to participate in insulin signaling and microbe recognition. Intelectin-1 functions both as a receptor for bacterial arabinogalactans and for lactoferrin. Having conserved ligand binding site residues, both human and mouse intelectin-1 bind the exocyclic vicinal diol of carbohydrate ligands such as galactofuranose. Protein function: Lectin that specifically recognizes microbial carbohydrate chains in a calcium-dependent manner (PubMed:11313366, PubMed:26148048). Binds to microbial glycans that contain a terminal acyclic 1,2-diol moiety, including beta- linked D-galactofuranose (beta-Galf), D-phosphoglycerol-modified glycans, D-glycero-D-talo-oct-2-ulosonic acid (KO) and 3-deoxy-D- manno-oct-2-ulosonic acid (KDO) (PubMed:26148048). Binds to glycans from Gram-positive and Gram-negative bacteria, including K.pneumoniae, S.pneumoniae, Y.pestis, P.mirabilis and P.vulgaris (PubMed:26148048). Does not bind human glycans (PubMed:26148048). Probably plays a role in the defense system against microorganisms (Probable). May function as adipokine that has no effect on basal glucose uptake but enhances insulin-stimulated glucose uptake in adipocytes (PubMed:16531507). Increases AKT phosphorylation in the absence and presence of insulin (PubMed:16531507). May interact with lactoferrin/LTF and increase its uptake, and may thereby play a role in iron absorption (PubMed:11747454, PubMed:23921499). [The UniProt Consortium]
Keywords: Anti-INTL, Anti-ITLN1, Anti-ITLN-1, Anti-Omentin, Anti-Intelectin-1, Anti-Endothelial lectin HL-1, Anti-Galactofuranose-binding lectin, Anti-Intestinal lactoferrin receptor, ITLN1 Antibody / Intelectin-1
Supplier: NSJ Bioreagents
Supplier-Nr: R32441

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids TDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLR
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-ITLN1 / Intelectin-1"
Write a review
or to review a product.
Viewed