Anti-IRF2

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
NSJ-R31965	100 µg		-	-	3 - 10 business days*		755.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

0.5mg/ml if reconstituted with 0.2ml sterile DI water. Specifically binds to the upstream... more

Close menu

Product information "Anti-IRF2"

0.5mg/ml if reconstituted with 0.2ml sterile DI water. Specifically binds to the upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)) and represses those genes. Also acts as an activator for several genes including H4 and IL7. Constitutively binds to the ISRE promoter to activate IL7. Involved in cell cycle regulation through binding the site II (HiNF-M) promoter region of H4 and activating transcription during cell growth. Antagonizes IRF1 transcriptional activation. [UniProt] Protein function: Specifically binds to the upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)) and represses those genes. Also acts as an activator for several genes including H4 and IL7. Constitutively binds to the ISRE promoter to activate IL7. Involved in cell cycle regulation through binding the site II (HiNF-M) promoter region of H4 and activating transcription during cell growth. Antagonizes IRF1 transcriptional activation. [The UniProt Consortium]

Keywords:	Anti-IRF2, Anti-IRF-2, Anti-Interferon regulatory factor 2, IRF2 Antibody
Supplier:	NSJ Bioreagents
Supplier-Nr:	R31965

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, rat
Immunogen:	Amino acids MTPASSSSRPDRETRASVIKKTSDITQARVKS of human IRF2 were used as the immunogen for the IRF2 antibody.
Format:	Purified