Anti-IFITM1 (CD225, IFI17, Interferon-induced Transmembrane Protein 1, Dispanin Subfamily A Member 2

Anti-IFITM1 (CD225, IFI17, Interferon-induced Transmembrane Protein 1, Dispanin Subfamily A Member 2
Item number Size Datasheet Manual SDS Delivery time Quantity Price
128253.100 100 µg - -

3 - 19 business days*

744.00€
 
IFN-induced antiviral protein that mediate cellular innate immunity to at least three major human... more
Product information "Anti-IFITM1 (CD225, IFI17, Interferon-induced Transmembrane Protein 1, Dispanin Subfamily A Member 2"
IFN-induced antiviral protein that mediate cellular innate immunity to at least three major human pathogens, namely influenza A H1N1 virus, West Nile virus, and dengue virus by inhibiting the early step(s) of replication. Plays a key role in the antiproliferative action of IFN-gamma either by inhibiting the ERK activition or by arresting cell growth in G1 phase in a p53-dependent manner. Implicated in the control of cell growth. Component of a multimeric complex involved in the transduction of antiproliferative and homotypic adhesion signals. Applications: Suitable for use in Western Blot. Other applications have not been tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA sequence: MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 128253

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Format: Affinity Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-IFITM1 (CD225, IFI17, Interferon-induced Transmembrane Protein 1, Dispanin Subfamily A Member 2"
Write a review
or to review a product.
Viewed