Anti-HMGB2

Anti-HMGB2
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32439 100 µg - -

3 - 10 business days*

503.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. High-mobility group protein B2, also known... more
Product information "Anti-HMGB2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. High-mobility group protein B2, also known as high-mobility group protein 2 (HMG-2), is a protein that in humans is encoded by the HMGB2 gene. This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination. Protein function: Multifunctional protein with various roles in different cellular compartments. May act in a redox sensitive manner. In the nucleus is an abundant chromatin-associated non-histone protein involved in transcription, chromatin remodeling and V(D)J recombination and probably other processes. Binds DNA with a preference to non-canonical DNA structures such as single-stranded DNA. Can bent DNA and enhance DNA flexibility by looping thus providing a mechanism to promote activities on various gene promoters by enhancing transcription factor binding and/or bringing distant regulatory sequences into close proximity (PubMed:7797075, PubMed:11909973, PubMed:19522541, PubMed:18413230, PubMed:19965638, PubMed:20123072). Involved in V(D)J recombination by acting as a cofactor of the RAG complex: acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS). Proposed to be involved in the innate immune response to nucleic acids by acting as a promiscuous immunogenic DNA/RNA sensor which cooperates with subsequent discriminative sensing by specific pattern recognition receptors. In the extracellular compartment acts as a chemokine. Promotes proliferation and migration of endothelial cells implicating AGER/RAGE (PubMed:19811285). Has antimicrobial activity in gastrointestinal epithelial tissues (PubMed:23877675). Involved in inflammatory response to antigenic stimulus coupled with proinflammatory activity. Involved in modulation of neurogenesis probably by regulation of neural stem proliferation. Involved in articular cartilage surface maintenance implicating LEF1 and the Wnt/beta-catenin pathway. [The UniProt Consortium]
Keywords: Anti-HMG2, Anti-HMGB2, Anti-HMG-2, Anti-High mobility group protein 2, Anti-High mobility group protein B2, HMGB2 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32439

Properties

Application: WB, IHC (paraffin), IF/ICC, FC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Reactivity: Human, Mouse, Rat
Immunogen: Amino acids KSDKARYDREMKNYVPPKGDKKGKKKDPNAPKR
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-HMGB2"
Write a review
or to review a product.
Anti-HMGB2 Anti-HMGB2
From 207.00€ *
Anti-HMGB2 Anti-HMGB2
483.00€ *
-10 %
Offer
Anti-HMGB2 Anti-HMGB2
314.00€ * 282.60€ *
-10 %
Offer
Anti-HMGB2 Anti-HMGB2
314.00€ * 282.60€ *
Viewed