Anti-HKDC1

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
NSJ-R32256	100 µg		-	-	3 - 10 business days*		755.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

0.5mg/ml if reconstituted with 0.2ml sterile DI water. HKDC1 (hexokinase domain containing 1) is... more

Close menu

Product information "Anti-HKDC1"

0.5mg/ml if reconstituted with 0.2ml sterile DI water. HKDC1 (hexokinase domain containing 1) is a protein that belongs to the hexokinase family and functions to catalyze the ATP-dependent conversion of D-hexose to D-hexose 6-phosphate.

Keywords:	Anti-HKDC1, EC=2.7.1.1, Anti-Putative hexokinase HKDC1, Anti-Hexokinase domain-containing protein 1, HKDC1 Antibody
Supplier:	NSJ Bioreagents
Supplier-Nr:	R32256

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human
Immunogen:	Amino acids KRHVQMESQFYPTPNEIIRGNGTELFEYVADCLAD of human HKDC1 were used as the immunogen for the HKDC1 antibody.
Format:	Purified