Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
NSJ-R32087 | 100 µg | - | - |
3 - 10 business days* |
755.00€
|
0.5mg/ml if reconstituted with 0.2ml sterile DI water. HSPA9 (heat shock 70kDa protein 9... more
Product information "Anti-GRP75"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. HSPA9 (heat shock 70kDa protein 9 (mortalin)), also known as GRP75, mot-2, mthsp75, PBP74, HSPA9B, MORTALIN or MORTALIN, PERINUCLEAR, is a highly conserved member of the HSP70 family of proteins. It functions as a chaperone in the mitochondria, cytoplasm, and centrosome. The HSPA9 gene is mapped to chromosome 5q31.2 based on an alignment of the HSPA9 sequence with the genomic sequence. Knockdown of HSPA9 in erythroid cultures was associated with an increased number of cells in the G0/G1 phase of the cell cycle and accelerated apoptosis. Knockdown of Hspa9 in mouse bone marrow cells, followed by transplantation into wildtype recipients, also resulted in loss of erythroid cell number. Haploinsufficiency for HSPA9 may contribute to abnormal hematopoiesis in myelodysplastic syndromes. This protein plays a role in the control of cell proliferation. Protein function: Chaperone protein which plays an important role in mitochondrial iron-sulfur cluster (ISC) biogenesis. Interacts with and stabilizes ISC cluster assembly proteins FXN, NFU1, NFS1 and ISCU (PubMed:26702583). Regulates erythropoiesis via stabilization of ISC assembly (PubMed:21123823, PubMed:26702583). May play a role in the control of cell proliferation and cellular aging. [The UniProt Consortium]
Keywords: | Anti-MOT, Anti-GRP75, Anti-HSPA9, Anti-PBP74, Anti-GRP-75, Anti-Mortalin, Anti-Peptide-binding protein 74, Anti-Heat shock 70 kDa protein 9, Anti-75 kDa glucose-regulated protein, Anti-Stress-70 protein, mitochondrial, GRP75 Antibody |
Supplier: | NSJ Bioreagents |
Supplier-Nr: | R32087 |
Properties
Application: | WB, IHC (paraffin), FC |
Antibody Type: | Polyclonal |
Conjugate: | No |
Host: | Rabbit |
Species reactivity: | human, mouse, monkey |
Immunogen: | Amino acids KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ of human HSPA9/GRP75 |
Format: | Purified |
Database Information
KEGG ID : | K04043 | Matching products |
UniProt ID : | P38646 | Matching products |
Gene ID | GeneID 3313 | Matching products |
Handling & Safety
Storage: | +4°C |
Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed