Anti-GPX4 (isoforms a/b/c)

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32085 100 µg - -

3 - 10 business days

503.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Glutathione peroxidase 4, also known as... more
Product information "Anti-GPX4 (isoforms a/b/c)"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Glutathione peroxidase 4, also known as GPX4, is an enzyme that in humans is encoded by the GPX4 gene. This gene encodes a member of the glutathione peroxidase protein family. Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. The encoded protein has been identified as a moonlighting protein based on its ability to serve dual functions as a peroxidase as well as a structural protein in mature spermatozoa. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified. Alternative splicing results in multiple transcript variants. Protein function: Protects cells against membrane lipid peroxidation and cell death. Required for normal sperm development and male fertility. Could play a major role in protecting mammals from the toxicity of ingested lipid hydroperoxides. Essential for embryonic development. Protects from radiation and oxidative damage. [The UniProt Consortium]
Keywords: Anti-GPX4, Anti-GPx-4, Anti-PHGPx, Anti-GSHPx-4, EC=1.11.1.12, Anti-Glutathione peroxidase 4, Anti-Phospholipid hydroperoxide glutathione peroxidase, mitochondrial, GPX4 Antibody (isoforms a/b/c)
Supplier-Nr: R32085

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Host: Rabbit
Reactivity: Human, Mouse, Rat
Immunogen: Amino acids ASRDDWRCARSMHEFSAKDIDGHMVNLDKYR of human GPX4 were used as the immunogen for the GPX4 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-GPX4 (isoforms a/b/c)"
Write a review
or to review a product.
Viewed