Anti-Glutathione S-transferase Mu 1 (GST Class-mu 1, GSTM1, GTM1, GSTM1-1, GSTM1a-1a, GSTM1b-1b, GST

Anti-Glutathione S-transferase Mu 1 (GST Class-mu 1, GSTM1, GTM1, GSTM1-1, GSTM1a-1a, GSTM1b-1b, GST
Item number Size Datasheet Manual SDS Delivery time Quantity Price
127372.100 100 µg - -

3 - 19 business days*

699.00€
 
GSTM1 is a glutathione S-transferase that belongs to the mu class. The mu class of enzymes... more
Product information "Anti-Glutathione S-transferase Mu 1 (GST Class-mu 1, GSTM1, GTM1, GSTM1-1, GSTM1a-1a, GSTM1b-1b, GST"
GSTM1 is a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDIL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 127372

Properties

Application: ELISA
Antibody Type: Monoclonal
Clone: 3B10
Conjugate: No
Host: Mouse
Species reactivity: human
Format: Affinity Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Glutathione S-transferase Mu 1 (GST Class-mu 1, GSTM1, GTM1, GSTM1-1, GSTM1a-1a, GSTM1b-1b, GST"
Write a review
or to review a product.
Viewed