Anti-GLUD2 (Glutamate Dehydrogenase 2, GDH2, GLUDP1)

Anti-GLUD2 (Glutamate Dehydrogenase 2, GDH2, GLUDP1)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
127361.50 50 µg - -

3 - 19 business days*

699.00€
 
GLUD2, Glutamate dehydrogenase 2, is important for recycling the chief excitatory... more
Product information "Anti-GLUD2 (Glutamate Dehydrogenase 2, GDH2, GLUDP1)"
GLUD2, Glutamate dehydrogenase 2, is important for recycling the chief excitatory neurotransmitter, glutamate, during neurotransmission. It is expressed in retina, testis and, at a lower level, brain. Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: MTPGFRDKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEGSILEVDCDILIPAATEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLERNILVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLLSVQESLERKFGKHGGTIPIVPTAEFQDSISGASEKDIVHSALAYTMERSARQIMHTAMKYNLGLDLRTAAYVNAIEKVFKVYSEAGVTFT, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 127361

Properties

Application: IHC, WB
Antibody Type: Polyclonal
Conjugate: No
Host: Mouse
Species reactivity: human
Format: Affinity Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-GLUD2 (Glutamate Dehydrogenase 2, GDH2, GLUDP1)"
Write a review
or to review a product.
Viewed