Anti-GAPDH

Anti-GAPDH
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32660 100 µg - -

3 - 10 business days*

549.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Glyceraldehyde 3-phosphate dehydrogenase... more
Product information "Anti-GAPDH"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Glyceraldehyde 3-phosphate dehydrogenase (GAPDH or G3PDH) is an enzyme of ~37 kDa that catalyzes the sixth step of glycolysis and thus serves to break down glucose for energy and carbon molecules. This gene encodes a member of the glyceraldehyde-3-phosphate dehydrogenase protein family. GAPDH is mapped to 12p13.31. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. The product of this gene catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The encoded protein has additionally been identified to have uracil DNA glycosylase activity in the nucleus. Protein function: Has both glyceraldehyde-3-phosphate dehydrogenase and nitrosylase activities, thereby playing a role in glycolysis and nuclear functions, respectively. Participates in nuclear events including transcription, RNA transport, DNA replication and apoptosis. Nuclear functions are probably due to the nitrosylase activity that mediates cysteine S-nitrosylation of nuclear target proteins such as SIRT1, HDAC2 and PRKDC. Modulates the organization and assembly of the cytoskeleton. Facilitates the CHP1-dependent microtubule and membrane associations through its ability to stimulate the binding of CHP1 to microtubules. Glyceraldehyde-3-phosphate dehydrogenase is a key enzyme in glycolysis that catalyzes the first step of the pathway by converting D-glyceraldehyde 3-phosphate (G3P) into 3-phospho-D- glyceroyl phosphate. Component of the GAIT (gamma interferon- activated inhibitor of translation) complex which mediates interferon-gamma-induced transcript-selective translation inhibition in inflammation processes. Upon interferon-gamma treatment assembles into the GAIT complex which binds to stem loop-containing GAIT elements in the 3'-UTR of diverse inflammatory mRNAs (such as ceruplasmin) and suppresses their translation. [The UniProt Consortium]
Keywords: Anti-GAPD, Anti-GAPDH, Anti-CDABP0047, EC=2.6.99.-, EC=1.2.1.12, Anti-Peptidyl-cysteine S-nitrosylase GAPDH, Anti-Glyceraldehyde-3-phosphate dehydrogenase, GAPDH Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32660

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Reactivity: Human
Immunogen: Amino acids 302-335 (ALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE) from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow. more
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-GAPDH"
Write a review
or to review a product.
Viewed