Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
NSJ-R31785 | 100 µg | - | - |
3 - 10 business days* |
755.00€
|
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Galectin-8 is a protein of the galectin... more
Product information "Anti-Galectin 8"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Galectin-8 is a protein of the galectin family that in humans is encoded by the LGALS8 gene. This gene encodes a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions. Alternatively spliced transcript variants encoding different isoforms have been identified. Protein function: Lectin with a marked preference for 3'-O-sialylated and 3'-O-sulfated glycans. [The UniProt Consortium]
Keywords: | Anti-Gal-8, Anti-LGALS8, Anti-PCTA-1, Anti-Po66-CBP, Anti-Galectin-8, Anti-Po66 carbohydrate-binding protein, Anti-Prostate carcinoma tumor antigen 1, Galectin 8 Antibody |
Supplier: | NSJ Bioreagents |
Supplier-Nr: | R31785 |
Properties
Application: | WB |
Antibody Type: | Polyclonal |
Conjugate: | No |
Host: | Rabbit |
Species reactivity: | human, rat |
Immunogen: | Amino acids HSLEYKHRFKELSSIDTLEINGDIHLLEVRSW of human Galectin 8 were used as the immunogen for the Galectin 8 antibody. |
Format: | Purified |
Database Information
KEGG ID : | K06832 | Matching products |
UniProt ID : | O00214 | Matching products |
Gene ID | GeneID 3964 | Matching products |
Handling & Safety
Storage: | -20°C |
Shipping: | -20°C (International: -20°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed