Anti-Galectin 8

Anti-Galectin 8
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31785 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Galectin-8 is a protein of the galectin... more
Product information "Anti-Galectin 8"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Galectin-8 is a protein of the galectin family that in humans is encoded by the LGALS8 gene. This gene encodes a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions. Alternatively spliced transcript variants encoding different isoforms have been identified. Protein function: Lectin with a marked preference for 3'-O-sialylated and 3'-O-sulfated glycans. [The UniProt Consortium]
Keywords: Anti-Gal-8, Anti-LGALS8, Anti-PCTA-1, Anti-Po66-CBP, Anti-Galectin-8, Anti-Po66 carbohydrate-binding protein, Anti-Prostate carcinoma tumor antigen 1, Galectin 8 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R31785

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, rat
Immunogen: Amino acids HSLEYKHRFKELSSIDTLEINGDIHLLEVRSW of human Galectin 8 were used as the immunogen for the Galectin 8 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Galectin 8"
Write a review
or to review a product.
Viewed