Anti-FOXA3

Anti-FOXA3
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32147 100 µg - -

3 - 10 business days

503.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Hepatocyte nuclear factor 3-gamma... more
Product information "Anti-FOXA3"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Hepatocyte nuclear factor 3-gamma (HNF-3G), also known as forkhead box protein A3 (FOXA3) or transcription factor 3G (TCF-3G), is a protein that in humans is encoded by the FOXA3 gene. This gene is mapped to 19q13.32. HNF-3G is a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. The crystal structure of a similar protein in rat has been resolved. Protein function: Transcription factor that is thought to act as a 'pioneer' factor opening the compacted chromatin for other proteins through interactions with nucleosomal core histones and thereby replacing linker histones at target enhancer and/or promoter sites. Originally described as a transcription activator for a number of liver genes such as AFP, albumin, tyrosine aminotransferase, PEPCK, etc. Interacts with the cis-acting regulatory regions of these genes. Involved in glucose homeostasis, binds to and activates transcription from the G6PC promoter. Binds to the CYP3A4 promoter and activates its transcription in cooperation with CEBPA. Binds to the CYP3A7 promoter together with members of the CTF/NF-I family. Involved in regulation of neuronal-specific transcription. May be involved in regulation of spermatogenesis. [The UniProt Consortium]
Keywords: Anti-FOXA3, Anti-HNF3G, Anti-HNF-3G, Anti-TCF-3G, Anti-HNF-3-gamma, Anti-Forkhead box protein A3, Anti-Transcription factor 3G, Anti-Fork head-related protein FKH H3, Anti-Hepatocyte nuclear factor 3-gamma, FOXA3 Antibody
Supplier-Nr: R32147

Properties

Application: WB
Antibody Type: Polyclonal
Host: Rabbit
Reactivity: Human, Mouse, Rat
Immunogen: Amino acids ELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGF of human FOXA3 were used as the immunogen for the FOXA3 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-FOXA3"
Write a review
or to review a product.
Viewed