Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
NSJ-R32251 | 100 µg | - | - |
3 - 10 business days* |
755.00€
|
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Organizes filamentous actin into bundles... more
Product information "Anti-Fascin"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Organizes filamentous actin into bundles with a minimum of 4.1:1 actin/fascin ratio. Plays a role in the organization of actin filament bundles and the formation of microspikes, membrane ruffles, and stress fibers. Important for the formation of a diverse set of cell protrusions, such as filopodia, and for cell motility and migration. [UniProt]Abnormal fascin expression or function has been implicated in breast cancer, colon cancer, esophageal squamous cell carcinoma, gallbladder cancer and prostate cancer. Protein function: Organizes filamentous actin into bundles with a minimum of 4.1:1 actin/fascin ratio. Plays a role in the organization of actin filament bundles and the formation of microspikes, membrane ruffles, and stress fibers. Important for the formation of a diverse set of cell protrusions, such as filopodia, and for cell motility and migration. [The UniProt Consortium]
Keywords: | Anti-p55, Anti-FAN1, Anti-FSCN1, Anti-Fascin, Anti-Singed-like protein, Anti-55 kDa actin-bundling protein, Fascin Antibody |
Supplier: | NSJ Bioreagents |
Supplier-Nr: | R32251 |
Properties
Application: | WB |
Antibody Type: | Polyclonal |
Conjugate: | No |
Host: | Rabbit |
Species reactivity: | human, rat |
Immunogen: | Amino acids KKQIWTLEQPPDEAGSAAVCLRSHLGRYLAAD of human Fascin were used as the immunogen for the Fascin antibody. |
Format: | Purified |
Database Information
KEGG ID : | K23551 | Matching products |
UniProt ID : | Q16658 | Matching products |
Gene ID | GeneID 6624 | Matching products |
Handling & Safety
Storage: | -20°C |
Shipping: | -20°C (International: -20°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed