Anti-EWS / EWSR1

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32181 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. This gene encodes a multifunctional... more
Product information "Anti-EWS / EWSR1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein. Mutations in this gene, specifically a t(11,22)(q24,q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and 14. Protein function: Might normally function as a transcriptional repressor. EWS- fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. [The UniProt Consortium]
Keywords: Anti-EWS, Anti-EWSR1, Anti-EWS oncogene, Anti-RNA-binding protein EWS, Anti-Ewing sarcoma breakpoint region 1 protein, EWS Antibody / EWSR1
Supplier: NSJ Bioreagents
Supplier-Nr: R32181

Properties

Application: WB, IHC (paraffin), (IF), ICC, IF, FC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH of human EWSR1
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-EWS / EWSR1"
Write a review
or to review a product.
Viewed