Anti-EIF3S1 (Eukaryotic Translation Initiation Factor 3, Subunit J, EIF3S1, EIF3-Alpha, EIF3-P35)

EIF3S2 is the largest of the EIFs. It consists of at least 10 nonidentical subunits in mammals. In S. cerevisiae the p39 subunit contains WD repeats, these are thought to mediate protein-protein interactions. The p39 protein appears to be essential for maintaining the integrity of the yeast EIF3 complex. The mammalian EIF3-p36 subunit is homologous to yeast p39. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAAAAAAAGDSDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEKKEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNNAVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEVLVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDYEDFM, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.