Anti-Connexin 32 / GJB1

Anti-Connexin 32 / GJB1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4180 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Gap junction beta-1 protein (GJB1), also... more
Product information "Anti-Connexin 32 / GJB1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Gap junction beta-1 protein (GJB1), also known as Connexin 32 (Cx32) is a transmembrane protein that in humans is encoded by the GJB1 gene. This gene encodes a member of the gap junction protein family. The gap junction proteins are membrane-spanning proteins that assemble to form gap junction channels that facilitate the transfer of ions and small molecules between cells. According to sequence similarities at the nucleotide and amino acid levels, the gap junction proteins are divided into two categories, alpha and beta. Mutations in this gene cause X-linked Charcot-Marie-Tooth disease, an inherited peripheral neuropathy. Alternatively spliced transcript variants encoding the same protein have been found for this gene. Protein function: One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. [The UniProt Consortium]
Keywords: Anti-Cx32, Anti-GJB1, Anti-CX32, Anti-Connexin-32, Anti-Gap junction beta-1 protein, Anti-GAP junction 28 kDa liver protein, Connexin 32 Antibody / GJB1
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4180

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: mouse, rat
Immunogen: Amino acids AMHVAHQQHIEKKMLRLEGHGDPLHLEEVKRHKVH were used as the immunogen for the Connexin 32 antibody.
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Connexin 32 / GJB1"
Write a review
or to review a product.
Viewed