Anti-CD38

Anti-CD38
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ5801 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. The protein encoded by this gene is a... more
Product information "Anti-CD38"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. The protein encoded by this gene is a non-lineage-restricted, type II transmembrane glycoprotein that synthesizes and hydrolyzes cyclic adenosine 5'-diphosphate-ribose, an intracellular calcium ion mobilizing messenger. The release of soluble protein and the ability of membrane-bound protein to become internalized indicate both extracellular and intracellular functions for the protein. This protein has an N-terminal cytoplasmic tail, a single membrane-spanning domain, and a C-terminal extracellular region with four N-glycosylation sites. Crystal structure analysis demonstrates that the functional molecule is a dimer, with the central portion containing the catalytic site. It is used as a prognostic marker for patients with chronic lymphocytic leukemia. Alternative splicing results in multiple transcript variants. Protein function: Synthesizes the second messengers cyclic ADP-ribose and nicotinate-adenine dinucleotide phosphate, the former a second messenger for glucose-induced insulin secretion. Also has cADPr hydrolase activity. Also moonlights as a receptor in cells of the immune system. [The UniProt Consortium]
Keywords: Anti-T10, Anti-CD38, Anti-ADPRC 1, EC=3.2.2.6, EC=2.4.99.20, Anti-cADPr hydrolase 1, Anti-ADP-ribosyl cyclase 1, Anti-Cyclic ADP-ribose hydrolase 1, Anti-2'-phospho-ADP-ribosyl cyclase, Anti-2'-phospho-cyclic-ADP-ribose transferase, CD38 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: RQ5801

Properties

Application: WB, IHC (paraffin), IF, FC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids EVHNLQPEKVQTLEAWVIHGGREDSRDLCQD from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CD38"
Write a review
or to review a product.
Viewed