• Please note that we do not deliver goods between 19.12.2019 and 03.01.2020 due to public holidays. However, we are happy to accept orders for deliveries in 2020 during this period.

Anti-Caspase-2

Anti-Caspase-2
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32097 100 µg - -

3 - 10 business days

503.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. CASP2 is equal to Caspase-2. And... more
Product information "Anti-Caspase-2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. CASP2 is equal to Caspase-2. And Caspase-2, which is involved in stress-induced apoptosis, is recruited into a large protein complex, the molecular composition of which remains elusive. It is showed that activation of caspase-2 occurs in a complex that contains the death domain-containing protein PIDD, whose expression is induced by p53, and the adaptor protein RAIDD. Increased PIDD expression resulted in spontaneous activation of caspase-2 and sensitization to apoptosis by genotoxic stimuli. Caspase-2 acts both as a positive and negative cell death effector, depending upon cell lineage and stage of development. Protein function: Involved in the activation cascade of caspases responsible for apoptosis execution. Might function by either activating some proteins required for cell death or inactivating proteins necessary for cell survival. [The UniProt Consortium]
Keywords: Anti-ICH1, Anti-CASP2, EC=3.4.22.55, Caspase-2 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32097

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Reactivity: Human, Mouse, Rat
Immunogen: Amino acids RNTKRGSWYIEALAQVFSERACDMHVADMLVK of human Caspase-2 were used as the immunogen for the Caspase-2 antibody. This sequence is found on the small subunit.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Caspase-2"
Write a review
or to review a product.
Viewed