Anti-BMP5

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32013 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Bone morphogenetic protein 5 is a protein... more
Product information "Anti-BMP5"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Bone morphogenetic protein 5 is a protein that in humans is encoded by the BMP5 gene. This gene encodes a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. These proteins are synthesized as prepropeptides, cleaved, and then processed into dimeric proteins. And this protein may act as an important signaling molecule within the trabecular meshwork and optic nerve head, and may play a potential role in glaucoma pathogenesis. This gene is differentially regulated during the formation of various tumors. Protein function: Induces cartilage and bone formation. [The UniProt Consortium]
Keywords: Anti-BMP5, Anti-BMP-5, Anti-Bone morphogenetic protein 5, BMP5 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32013

Properties

Application: WB, IHC (paraffin), FC, ELISA
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL of human BMP5 were used as the immunogen for the BMP5 antibody.
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-BMP5"
Write a review
or to review a product.
Viewed