Anti-Bcl-2 (Middle Region)

Anti-Bcl-2 (Middle Region)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32814 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Immunoreactive BCL2 protein is in the... more
Product information "Anti-Bcl-2 (Middle Region)"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Immunoreactive BCL2 protein is in the neoplastic cells of almost all follicular lymphomas whereas no BCL2 protein was detected in follicles affected by nonneoplastic processes or in normal lymphoid tissue. Every tumor with molecular-genetic evidence of t(14,18) translocation expressed detectable levels of BCL2 protein, regardless of whether the breakpoint was located in or at a distance from the BCL2 gene. Overexpression of BCL2 blocks the apoptotic death of a pro-B-lymphocyte cell line. Protein function: Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). May attenuate inflammation by impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release (PubMed:17418785). [The UniProt Consortium]
Keywords: Anti-BCL2, Anti-Apoptosis regulator Bcl-2, Bcl-2 Antibody (Middle Region)
Supplier: NSJ Bioreagents
Supplier-Nr: R32814

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids 102-140 (DDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRD) were used as the immunogen for the Bcl-2 antibody.
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Bcl-2 (Middle Region)"
Write a review
or to review a product.
Viewed